PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S04200.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family ZF-HD
Protein Properties Length: 242aa    MW: 25574 Da    PI: 4.7038
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S04200.10genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer57.24e-186697335
    ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegee 35
                   +vrY+eClkNhA+++GghavDGCgEfm++ ge+
  Jcr4S04200.10 66 SVRYRECLKNHAVNIGGHAVDGCGEFMAA-GEK 97
                   79**************************9.554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047702.0E-156798IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015664.5E-156898IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257748.0E-106897IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152317.17369129IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466899.32E-20130202IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.4E-30132203IPR009057Homeodomain-like
TIGRFAMsTIGR015653.2E-26144200IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MDFDDEHEDQ EEEMGMPVPA GYDAISNSAR PKMGPGTGGA GEGGGGGGEG ASTIATATNT  60
RKSGSSVRYR ECLKNHAVNI GGHAVDGCGE FMAAGEKGLL ALPAASGGGA GGDVVGGGYS  120
REEEDVSNPS SSGGGGGGVS GGSKKRFRTK FTQEQKDKML DFAERLGWRI QKHDEVAVEQ  180
FCGENGVKRH VLKVWMHNNK HTLVDDIYQE RIKNGKKFVI DNLFRMDGEE DGDGDDDDPF  240
IS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A2e-291432021675ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC3447941e-160KC344794.1 Jatropha curcas microsatellite AG143 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002306552.21e-73hypothetical protein POPTR_0005s17620g
SwissprotQ9SB612e-54ZHD2_ARATH; Zinc-finger homeodomain protein 2
TrEMBLB9H6X72e-73B9H6X7_POPTR; Uncharacterized protein
STRINGPOPTR_0005s17620.14e-73(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20634253
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.16e-32homeobox protein 22